Kitl (Mouse) Recombinant Protein
  • Kitl (Mouse) Recombinant Protein

Kitl (Mouse) Recombinant Protein

Ref: AB-P7310
Kitl (Mouse) Recombinant Protein

Información del producto

Mouse Kitl (P20826, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris.
Información adicional
Size 10 ug
Gene Name Kitl
Gene Alias Clo|Con|Gb|Kitlg|Mgf|SCF|SF|SLF|Sl|Steel|contrasted
Gene Description kit ligand
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 17311

Enviar un mensaje


Kitl (Mouse) Recombinant Protein

Kitl (Mouse) Recombinant Protein