Il1b (Mouse) Recombinant Protein
  • Il1b (Mouse) Recombinant Protein

Il1b (Mouse) Recombinant Protein

Ref: AB-P7305
Il1b (Mouse) Recombinant Protein

Información del producto

Mouse Il1b (P10749, 118 a.a. - 269 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il1b
Gene Alias IL-1beta|Il-1b
Gene Description interleukin 1 beta
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16176

Enviar un mensaje


Il1b (Mouse) Recombinant Protein

Il1b (Mouse) Recombinant Protein