EPO (Human) Recombinant Protein
  • EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein

Ref: AB-P7301
EPO (Human) Recombinant Protein

Información del producto

Human EPO (P01588, 28 a.a. - 193 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name EPO
Gene Alias EP|MGC138142
Gene Description erythropoietin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 2056

Enviar un mensaje


EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein