CSF3 (Human) Recombinant Protein
  • CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein

Ref: AB-P7300
CSF3 (Human) Recombinant Protein

Información del producto

Human CSF3 (Q8N4W3, 27 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 1440

Enviar un mensaje


CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein