Tnfsf13 (Mouse) Recombinant Protein
  • Tnfsf13 (Mouse) Recombinant Protein

Tnfsf13 (Mouse) Recombinant Protein

Ref: AB-P7297
Tnfsf13 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf13 (Q9D777, 50 a.a. - 241 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Tnfsf13
Gene Alias 2310026N09Rik|APRIL|MGC106105|TALL2|TRDL1|Tnfsf12
Gene Description tumor necrosis factor (ligand) superfamily, member 13
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 69583

Enviar un mensaje


Tnfsf13 (Mouse) Recombinant Protein

Tnfsf13 (Mouse) Recombinant Protein