LEP (Human) Recombinant Protein
  • LEP (Human) Recombinant Protein

LEP (Human) Recombinant Protein

Ref: AB-P7294
LEP (Human) Recombinant Protein

Información del producto

Human LEP (P41159, 22 a.a. - 167 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 5 mg
Gene Name LEP
Gene Alias FLJ94114|OB|OBS
Gene Description leptin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 3952

Enviar un mensaje


LEP (Human) Recombinant Protein

LEP (Human) Recombinant Protein