Ver mas grande
LEP (Human) Recombinant Protein
AB-P7294
Producto nuevo
LEP (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 5 mg |
| Gene Name | LEP |
| Gene Alias | FLJ94114|OB|OBS |
| Gene Description | leptin |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
| Gene ID | 3952 |
Más información
Human LEP (P41159, 22 a.a. - 167 a.a.) partial recombinant protein expressed in Escherichia coli.