Hbegf (Mouse) Recombinant Protein
  • Hbegf (Mouse) Recombinant Protein

Hbegf (Mouse) Recombinant Protein

Ref: AB-P7277
Hbegf (Mouse) Recombinant Protein

Información del producto

Mouse Hbegf (Q06186, 63 a.a. - 148 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Hbegf
Gene Alias AW047313|DTS|Dtr|HB-EGF|Hegfl|MGC107656
Gene Description heparin-binding EGF-like growth factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 15200

Enviar un mensaje


Hbegf (Mouse) Recombinant Protein

Hbegf (Mouse) Recombinant Protein