IL19 (Human) Recombinant Protein
  • IL19 (Human) Recombinant Protein

IL19 (Human) Recombinant Protein

Ref: AB-P7270
IL19 (Human) Recombinant Protein

Información del producto

Human IL19 (Q9UHD0, 25 a.a. - 177 a.a.) F175S mutant partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL19
Gene Alias IL-10C|MDA1|NG.1|ZMDA1
Gene Description interleukin 19
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 29949

Enviar un mensaje


IL19 (Human) Recombinant Protein

IL19 (Human) Recombinant Protein