FLT3LG (Human) Recombinant Protein
  • FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein

Ref: AB-P7267
FLT3LG (Human) Recombinant Protein

Información del producto

Human FLT3LG (P49771, 27 a.a. - 185 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name FLT3LG
Gene Alias FL
Gene Description fms-related tyrosine kinase 3 ligand
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 2323

Enviar un mensaje


FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein