IL1B (Human) Recombinant Protein
  • IL1B (Human) Recombinant Protein

IL1B (Human) Recombinant Protein

Ref: AB-P7265
IL1B (Human) Recombinant Protein

Información del producto

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL1B
Gene Alias IL-1|IL1-BETA|IL1F2
Gene Description interleukin 1, beta
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 3553

Enviar un mensaje


IL1B (Human) Recombinant Protein

IL1B (Human) Recombinant Protein