Ver mas grande
Il1a (Mouse) Recombinant Protein
AB-P7257
Producto nuevo
Il1a (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Il1a |
| Gene Alias | Il-1a |
| Gene Description | interleukin 1 alpha |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSA_x005F_x000D__x000D_241AYPELFIATKEQSRVHLARGLPSMTDFQIS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 16175 |
Más información
Mouse Il1a (Q3U0Y6, 115 a.a. - 279 a.a.) partial recombinant protein expressed in Escherichia coli.