IFNW1 (Human) Recombinant Protein
  • IFNW1 (Human) Recombinant Protein

IFNW1 (Human) Recombinant Protein

Ref: AB-P7254
IFNW1 (Human) Recombinant Protein

Información del producto

Human IFNW1 (P05000, 24 a.a. - 195 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IFNW1
Gene Alias -
Gene Description interferon, omega 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN_x005F_x000D__x000D_181MQERLRSKDRDLGSS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 3467

Enviar un mensaje


IFNW1 (Human) Recombinant Protein

IFNW1 (Human) Recombinant Protein