Ver mas grande
TMFB4X (Human) Recombinant Protein
AB-P7253
Producto nuevo
TMFB4X (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | TMSB4X |
| Gene Alias | FX|PTMB4|TB4X|TMSB4 |
| Gene Description | thymosin beta 4, X-linked |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 7114 |
Más información
Human TMFB4X (P62328, 2 a.a. - 44 a.a.) partial recombinant protein expressed in Escherichia coli.