TMFB4X (Human) Recombinant Protein
  • TMFB4X (Human) Recombinant Protein

TMFB4X (Human) Recombinant Protein

Ref: AB-P7253
TMFB4X (Human) Recombinant Protein

Información del producto

Human TMFB4X (P62328, 2 a.a. - 44 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name TMSB4X
Gene Alias FX|PTMB4|TB4X|TMSB4
Gene Description thymosin beta 4, X-linked
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 7114

Enviar un mensaje


TMFB4X (Human) Recombinant Protein

TMFB4X (Human) Recombinant Protein