Defb2 (Mouse) Recombinant Protein
  • Defb2 (Mouse) Recombinant Protein

Defb2 (Mouse) Recombinant Protein

Ref: AB-P7242
Defb2 (Mouse) Recombinant Protein

Información del producto

Mouse Defb2 (P82020, 21 a.a. - 71 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Defb2
Gene Alias MGC129140|MGC129141
Gene Description defensin beta 2
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 13215

Enviar un mensaje


Defb2 (Mouse) Recombinant Protein

Defb2 (Mouse) Recombinant Protein