Cxcl16 (Mouse) Recombinant Protein
  • Cxcl16 (Mouse) Recombinant Protein

Cxcl16 (Mouse) Recombinant Protein

Ref: AB-P7228
Cxcl16 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl16 (Q8BSU2, 27 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Cxcl16
Gene Alias 0910001K24Rik|AV290116|BB024863|SR-PSOX|Zmynd15
Gene Description chemokine (C-X-C motif) ligand 16
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 66102

Enviar un mensaje


Cxcl16 (Mouse) Recombinant Protein

Cxcl16 (Mouse) Recombinant Protein