CCL20 (Human) Recombinant Protein
  • CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein

Ref: AB-P7218
CCL20 (Human) Recombinant Protein

Información del producto

Human CCL20 (P78556, 27 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL20
Gene Alias CKb4|LARC|MIP-3a|MIP3A|SCYA20|ST38
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 6364

Enviar un mensaje


CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein