Exendin-4 (Reptilia) Recombinant Protein
  • Exendin-4 (Reptilia) Recombinant Protein

Exendin-4 (Reptilia) Recombinant Protein

Ref: AB-P7195
Exendin-4 (Reptilia) Recombinant Protein

Información del producto

Reptilia Exendin-4 (P26349, 48 a.a. - 86 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml

Enviar un mensaje


Exendin-4 (Reptilia) Recombinant Protein

Exendin-4 (Reptilia) Recombinant Protein