ORF33 (Human) Recombinant Protein
  • ORF33 (Human) Recombinant Protein

ORF33 (Human) Recombinant Protein

Ref: AB-P7194
ORF33 (Human) Recombinant Protein

Información del producto

Human ORF33 (P09286, 18 a.a. - 303 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name ORF33
Gene Alias -
Gene Description serine protease (N-terminal region)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE_x005F_x005F_x005F_x000D__x005F_x000D__x000D_181RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNY
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 1487717

Enviar un mensaje


ORF33 (Human) Recombinant Protein

ORF33 (Human) Recombinant Protein