Ver mas grande
Abcc8 (Human) Recombinant Protein
AB-P7193
Producto nuevo
Abcc8 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GABRA6 |
| Gene Alias | MGC116903|MGC116904 |
| Gene Description | gamma-aminobutyric acid (GABA) A receptor, alpha 6 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFILLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYG181MLLLVEVNVIRVRRYVFFKTPREVKPPEDLQDLGV |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 2559 |
Más información
Human Abcc8 (P09429, 1 a.a. - 215 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.