Vegfa (Mouse) Recombinant Protein Ver mas grande

Vegfa (Mouse) Recombinant Protein

AB-P7185

Producto nuevo

Vegfa (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name Vegfa
Gene Alias Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 22339

Más información

Mouse Vegfa (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein