CSF2 (Rhesus Macaque) Recombinant Protein
  • CSF2 (Rhesus Macaque) Recombinant Protein

CSF2 (Rhesus Macaque) Recombinant Protein

Ref: AB-P7177
CSF2 (Rhesus Macaque) Recombinant Protein

Información del producto

Rhesus Macaque CSF2 (Q9GL44, 18 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name GM-CSF
Gene Alias CSF2
Gene Description granulocyte-macrophage colony-stimulating factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 574371

Enviar un mensaje


CSF2 (Rhesus Macaque) Recombinant Protein

CSF2 (Rhesus Macaque) Recombinant Protein