DEFB103B (Human) Recombinant Protein
  • DEFB103B (Human) Recombinant Protein

DEFB103B (Human) Recombinant Protein

Ref: AB-P7173
DEFB103B (Human) Recombinant Protein

Información del producto

Human DEFB103B (P81534, 23 a.a. - 67 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB103A
Gene Alias DEFB103|DEFB3|HBD-3|HBD3|HBP-3|HBP3
Gene Description defensin, beta 103A
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 55894

Enviar un mensaje


DEFB103B (Human) Recombinant Protein

DEFB103B (Human) Recombinant Protein