Ver mas grande
DEFB103B (Human) Recombinant Protein
AB-P7173
Producto nuevo
DEFB103B (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | DEFB103A |
| Gene Alias | DEFB103|DEFB3|HBD-3|HBD3|HBP-3|HBP3 |
| Gene Description | defensin, beta 103A |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 55894 |
Más información
Human DEFB103B (P81534, 23 a.a. - 67 a.a.) partial recombinant protein expressed in Escherichia coli.