DFB4A (Human) Recombinant Protein
  • DFB4A (Human) Recombinant Protein

DFB4A (Human) Recombinant Protein

Ref: AB-P7172
DFB4A (Human) Recombinant Protein

Información del producto

Human DFB4A (O15263, 24 a.a. - 64 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB4
Gene Alias DEFB-2|DEFB102|DEFB2|HBD-2|SAP1
Gene Description defensin, beta 4
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 1673

Enviar un mensaje


DFB4A (Human) Recombinant Protein

DFB4A (Human) Recombinant Protein