BMP7 (Human) Recombinant Protein
  • BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein

Ref: AB-P7170
BMP7 (Human) Recombinant Protein

Información del producto

Human BMP7 (P18075, 293 a.a. - 431 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name BMP7
Gene Alias OP-1
Gene Description bone morphogenetic protein 7
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Form Lyophilized
Storage Buffer Lyophilized from 10 mM HAc up to 0.1 - 1.0 mg/ml
Gene ID 655

Enviar un mensaje


BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein