TNFRSF13C (Human) Recombinant Protein
  • TNFRSF13C (Human) Recombinant Protein

TNFRSF13C (Human) Recombinant Protein

Ref: AB-P7161
TNFRSF13C (Human) Recombinant Protein

Información del producto

Human TNFRSF13C (Q96RJ3, 1 a.a. - 76 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TNFRSF13C
Gene Alias BAFF-R|BAFFR|CD268|MGC138235
Gene Description tumor necrosis factor receptor superfamily, member 13C
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 115650

Enviar un mensaje


TNFRSF13C (Human) Recombinant Protein

TNFRSF13C (Human) Recombinant Protein