TSLP (Human) Recombinant Protein
  • TSLP (Human) Recombinant Protein

TSLP (Human) Recombinant Protein

Ref: AB-P7159
TSLP (Human) Recombinant Protein

Información del producto

Human TSLP (Q969D9, 29 a.a. - 159 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name TSLP
Gene Alias -
Gene Description thymic stromal lymphopoietin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 85480

Enviar un mensaje


TSLP (Human) Recombinant Protein

TSLP (Human) Recombinant Protein