IL13 (Human) Recombinant Protein
  • IL13 (Human) Recombinant Protein

IL13 (Human) Recombinant Protein

Ref: AB-P7154
IL13 (Human) Recombinant Protein

Información del producto

Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL13
Gene Alias ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600
Gene Description interleukin 13
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 3596

Enviar un mensaje


IL13 (Human) Recombinant Protein

IL13 (Human) Recombinant Protein