VEGFA (Human) Recombinant Protein
  • VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein

Ref: AB-P7145
VEGFA (Human) Recombinant Protein

Información del producto

Human VEGFA (P15692-4, 27 a.a. - 191 a.a.) partial recombinant protein expressed in Pichia pastoris.
Información adicional
Size 10 ug
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR
Form Lyophilized
Quality control testing 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 7422

Enviar un mensaje


VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein