PTH (Human) Recombinant Protein
  • PTH (Human) Recombinant Protein

PTH (Human) Recombinant Protein

Ref: AB-P7132
PTH (Human) Recombinant Protein

Información del producto

Human PTH (P01270, 32 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PTH
Gene Alias PTH1
Gene Description parathyroid hormone
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 5741

Enviar un mensaje


PTH (Human) Recombinant Protein

PTH (Human) Recombinant Protein