IL1RN (Human) Recombinant Protein
  • IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein

Ref: AB-P7127
IL1RN (Human) Recombinant Protein

Información del producto

Human IL1RN (P81510-1, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 3557

Enviar un mensaje


IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein