Ver mas grande
IL1RN (Human) Recombinant Protein
AB-P7127
Producto nuevo
IL1RN (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL1RN |
| Gene Alias | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
| Gene Description | interleukin 1 receptor antagonist |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 3557 |
Más información
Human IL1RN (P81510-1, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.