Il11 (Mouse) Recombinant Protein
  • Il11 (Mouse) Recombinant Protein

Il11 (Mouse) Recombinant Protein

Ref: AB-P7121
Il11 (Mouse) Recombinant Protein

Información del producto

Mouse Il11 (P47873, 23 a.a. - 199 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name Il11
Gene Alias IL-11
Gene Description interleukin 11
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16156

Enviar un mensaje


Il11 (Mouse) Recombinant Protein

Il11 (Mouse) Recombinant Protein