Ver mas grande
IL3 (Human) Recombinant Protein
AB-P7113
Producto nuevo
IL3 (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL3 |
| Gene Alias | IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF |
| Gene Description | interleukin 3 (colony-stimulating factor, multiple) |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 3562 |
Más información
Human IL3 (Q6GS87, 20 a.a. - 152 a.a.) partial recombinant protein expressed in CHO cells.