IFNG (Human) Recombinant Protein
  • IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein

Ref: AB-P7111
IFNG (Human) Recombinant Protein

Información del producto

Human IFNG (P01579, 24 a.a. - 166 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 3458

Enviar un mensaje


IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein