Ifng (Rat) Recombinant Protein
  • Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein

Ref: AB-P7109
Ifng (Rat) Recombinant Protein

Información del producto

Rat Ifng (P01581, 23 a.a.- 156 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Ifng
Gene Alias IFNG2
Gene Description interferon gamma
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 25712

Enviar un mensaje


Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein