CSF1 (Human) Recombinant Protein
  • CSF1 (Human) Recombinant Protein

CSF1 (Human) Recombinant Protein

Ref: AB-P7105
CSF1 (Human) Recombinant Protein

Información del producto

Human CSF1 (P09603, 33 a.a - 190 a.a) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name CSF1
Gene Alias MCSF|MGC31930
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 1435

Enviar un mensaje


CSF1 (Human) Recombinant Protein

CSF1 (Human) Recombinant Protein