IL6 (Human)Recombinant Protein
  • IL6 (Human)Recombinant Protein

IL6 (Human)Recombinant Protein

Ref: AB-P7103
IL6 (Human)Recombinant Protein

Información del producto

Human IL6 (Q75MH2, 29 a.a - 212 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name IL6
Gene Alias BSF2|HGF|HSF|IFNB2|IL-6
Gene Description interleukin 6 (interferon, beta 2)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 3569

Enviar un mensaje


IL6 (Human)Recombinant Protein

IL6 (Human)Recombinant Protein