IL10 (Human) Recombinant Protein
  • IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein

Ref: AB-P7102
IL10 (Human) Recombinant Protein

Información del producto

Human IL10 (P22301 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 3586

Enviar un mensaje


IL10 (Human) Recombinant Protein

IL10 (Human) Recombinant Protein