Kitlg (Rat) Recombinant Protein
  • Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein

Ref: AB-P7098
Kitlg (Rat) Recombinant Protein

Información del producto

Rat Kitlg (P21581, 26 a.a - 189 a.a.) partial recombinant protein expressed in HEK293 cell.
Información adicional
Size 10 ug
Gene Name Kitlg
Gene Alias Kitl|Mgf|SCF
Gene Description KIT ligand
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 60427

Enviar un mensaje


Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein