IL11 (Human) Recombinant Protein
  • IL11 (Human) Recombinant Protein

IL11 (Human) Recombinant Protein

Ref: AB-P7097
IL11 (Human) Recombinant Protein

Información del producto

Human IL11 (P202809-1, 22 a.a. - 199 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 5 ug
Gene Name IL11
Gene Alias AGIF|IL-11
Gene Description interleukin 11
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSL
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 3589

Enviar un mensaje


IL11 (Human) Recombinant Protein

IL11 (Human) Recombinant Protein