IL11 (Human) Recombinant Protein Ver mas grande

IL11 (Human) Recombinant Protein

AB-P7097

Producto nuevo

IL11 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 5 ug
Gene Name IL11
Gene Alias AGIF|IL-11
Gene Description interleukin 11
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSL
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 3589

Más información

Human IL11 (P202809-1, 22 a.a. - 199 a.a.) partial recombinant protein expressed in CHO cell.

Consulta sobre un producto

IL11 (Human) Recombinant Protein

IL11 (Human) Recombinant Protein