SARS-CoV-2 S RBD (Delta) Recombinant Protein Ver mas grande

SARS-CoV-2 S RBD (Delta) Recombinant Protein

AB-P6900

Producto nuevo

SARS-CoV-2 S RBD (Delta) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.


Hoja técnica

Size 25 ug
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Concentration >= 10 ug/ml
Application Key WB,ELISA,SDS-PAGE
Immunogen Prot. Seq RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Form Liquid
Antigen species Target species Viruses
Quality control testing SDS-PAGE and Western Blot
Storage Buffer In PBS.
Host Human HEK293H cells

Más información

Purified SARS-CoV-2 S RBD (Delta) (no protein_acc, 317 a.a. - 539 a.a.) COVID-19 recombinant protein with Rabbit Fc tag at C-terminus expressed in human cells.

Consulta sobre un producto

SARS-CoV-2 S RBD (Delta) Recombinant Protein

SARS-CoV-2 S RBD (Delta) Recombinant Protein