Ver mas grande
S1 (SARS-CoV-2 Alpha Variant) Recombinant Protein
AB-P6705
Producto nuevo
S1 (SARS-CoV-2 Alpha Variant) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 50 ug |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA,SDS-PAGE |
| Immunogen Prot. Seq | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAISGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPR |
| Form | Liquid |
| Recomended Dilution | ELISA<br>SDS-PAGE<br>Western Blot<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | SARS-CoV-2 |
| Quality control testing | SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4. |
Más información
SARS-CoV-2 Alpha Variant S1 (GISAID No. EPI_ISL_601443, 16 a.a. - 683 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.