S1 (SARS-CoV-2) Recombinant Protein
  • S1 (SARS-CoV-2) Recombinant Protein

S1 (SARS-CoV-2) Recombinant Protein

Ref: AB-P6673
S1 (SARS-CoV-2) Recombinant Protein

Información del producto

SARS-CoV-2 S1 (QHD43416.1, 16 a.a. - 685 a.a.) partial recombinant protein with His tag at C-terminal expressed in HEK293 cells.
Información adicional
Size 100 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DGSMVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYY
Form Liquid
Recomended Dilution Bioactivity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species SARS-CoV-2
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).

Enviar un mensaje


S1 (SARS-CoV-2) Recombinant Protein

S1 (SARS-CoV-2) Recombinant Protein