AB-P6653
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 ug |
Storage Conditions | Store at -20ºC on dry atmosphere.<br>Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20ºC or -80ºC.<br>Aliquot to avoid r |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVT |
Form | Lyophilized |
Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Viruses |
Quality control testing | SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | Lyophilized from PBS, pH 7.4. |