Ver mas grande
S1 (SARS-CoV-2) RBD Recombinant Protein
AB-P6652
Producto nuevo
S1 (SARS-CoV-2) RBD Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20ºC or -80ºC.<br>Aliquot to avoid r |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Form | Lyophilized |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | SARS-CoV-2 |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
Más información
SARS-CoV-2 S1 RBD (QHD43416.1, 319 a.a.- 541 a.a.) partial recombinant protein with His tag at C-terminal expressed in Escherichia coli.