Il22 (Mouse) Recombinant Protein Ver mas grande

Il22 (Mouse) Recombinant Protein

AB-P6451

Producto nuevo

Il22 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name Il22
Gene Alias IL-22|IL-TIF|Iltif
Gene Description interleukin 22
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 50929

Más información

Mouse Il22 (Q9JJY9) recombinant protein expressed in E.Coli.

Consulta sobre un producto

Il22 (Mouse) Recombinant Protein

Il22 (Mouse) Recombinant Protein