VEGFA (Human) Recombinant Protein
  • VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein

Ref: AB-P6447
VEGFA (Human) Recombinant Protein

Información del producto

Human VEGFA (P15692-4) recombinant protein expressed in E.Coli.
Información adicional
Size 10 ug
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Storage Prior to Reconstitution: -20C.
Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 7422

Enviar un mensaje


VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein