Ver mas grande
TNFRSF12A (Human) Recombinant Protein
AB-P6425
Producto nuevo
TNFRSF12A (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | TNFRSF12A |
| Gene Alias | CD266|FN14|TWEAKR |
| Gene Description | tumor necrosis factor receptor superfamily, member 12A |
| Storage Conditions | Lyophilized protein is stable at -20ºC for 2 years.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 51330 |
Más información
Human TNFRSF12A (Q9NP84) recombinant protein expressed in E. Coli.