AB-P6425
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 25 ug |
Gene Name | TNFRSF12A |
Gene Alias | CD266|FN14|TWEAKR |
Gene Description | tumor necrosis factor receptor superfamily, member 12A |
Storage Conditions | Lyophilized protein is stable at -20ºC for 2 years.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB,Func |
Immunogen Prot. Seq | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP |
Form | Lyophilized |
Storage Buffer | Lyophilized from PBS, pH 7.2. |
Gene ID | 51330 |