TNFRSF12A (Human) Recombinant Protein
  • TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein

Ref: AB-P6425
TNFRSF12A (Human) Recombinant Protein

Información del producto

Human TNFRSF12A (Q9NP84) recombinant protein expressed in E. Coli.
Información adicional
Size 25 ug
Gene Name TNFRSF12A
Gene Alias CD266|FN14|TWEAKR
Gene Description tumor necrosis factor receptor superfamily, member 12A
Storage Conditions Lyophilized protein is stable at -20C for 2 years.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 51330

Enviar un mensaje


TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein