TNFSF12 (Human) Recombinant Protein
  • TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein

Ref: AB-P6424
TNFSF12 (Human) Recombinant Protein

Información del producto

Human TNFSF12 (O43508) recombinant protein expressed in E. Coli.
Información adicional
Size 25 ug
Gene Name TNFSF12
Gene Alias APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene Description tumor necrosis factor (ligand) superfamily, member 12
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8742

Enviar un mensaje


TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein