Thpo (Rat) Recombinant Protein Ver mas grande

Thpo (Rat) Recombinant Protein

AB-P6419

Producto nuevo

Thpo (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name Thpo
Gene Alias -
Gene Description thrombopoietin
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 81811

Más información

Rat Thpo (P49745) recombinant protein expressed in CHO cells.

Consulta sobre un producto

Thpo (Rat) Recombinant Protein

Thpo (Rat) Recombinant Protein