Thpo (Rat) Recombinant Protein
  • Thpo (Rat) Recombinant Protein

Thpo (Rat) Recombinant Protein

Ref: AB-P6419
Thpo (Rat) Recombinant Protein

Información del producto

Rat Thpo (P49745) recombinant protein expressed in CHO cells.
Información adicional
Size 25 ug
Gene Name Thpo
Gene Alias -
Gene Description thrombopoietin
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 81811

Enviar un mensaje


Thpo (Rat) Recombinant Protein

Thpo (Rat) Recombinant Protein