TLR4 (Human) Recombinant Protein
  • TLR4 (Human) Recombinant Protein

TLR4 (Human) Recombinant Protein

Ref: AB-P6418
TLR4 (Human) Recombinant Protein

Información del producto

Human TLR4 (O00206) recombinant protein expressed in CHO cells.
Información adicional
Size 25 ug
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Stored at -20C for 2 years.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALE
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 7099

Enviar un mensaje


TLR4 (Human) Recombinant Protein

TLR4 (Human) Recombinant Protein